PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A07G0539
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 174aa    MW: 18876.1 Da    PI: 6.5114
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A07G0539genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like52.51.1e-161221522555
      G2-like  25 ekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                   +AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Gh_A07G0539 122 YRATPKSVLELMDVKDLTLAHVKSHLQMYRT 152
                  59****************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.33E-6119153IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.7E-15122153IPR009057Homeodomain-like
TIGRFAMsTIGR015571.0E-11123153IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 174 aa     Download sequence    Send to blast
MSDKGDFTSL NRIPDLSLHI SPPNSAPSSI CAAGDSSFDI WRKDDGVNPK SHSDSSIKPA  60
SQADTQLSLA NPTTSALEAE SESPWEKKSF APLARTDDDN IYHGISLLDV SGLKPIKGIP  120
VYRATPKSVL ELMDVKDLTL AHVKSHLQMY RTIKSTDKPA SSSGNSYSSL HFLY
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.193990.0boll
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012469060.12e-81PREDICTED: transcription repressor KAN1-like isoform X1
TrEMBLA0A0D2NF651e-81A0A0D2NF65_G
STRINGPOPTR_0012s03900.12e-35(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM66062645
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17695.12e-20G2-like family protein